Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zhx3 Rabbit Polyclonal Antibody (HRP)

Zhx3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tix, Tix1, mKIAA0395, 1810059C13Rik, 4932418O04Rik, 9530010N21Rik

UniProt

Q8C0Q2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NGEPVAVHKVLGDAYSELSENSESWEPSAPEASSEPFDTSSPQSGRQLEA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

104kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_796237

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse XL Cytokine Premixed Kit Luminex Performance Assay
FCSTM20-10 1 Kit

Mouse XL Cytokine Premixed Kit Luminex Performance Assay

Sign In for Pricing
View Details
Recombinant Human GCHFR Protein, N-GST & C-His
E55P7810 50 µg

Recombinant Human GCHFR Protein, N-GST & C-His

Sign In for Pricing
View Details
Human ANAPC1 siRNA
abx907444-01 15 nmol

Human ANAPC1 siRNA

Sign In for Pricing
View Details
Human ANAPC1 siRNA
abx907444-02 30 nmol

Human ANAPC1 siRNA

Sign In for Pricing
View Details
Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) Magnetic Luminex Assay Kit
LKU604950 96 Tests

Nuclear Factor Of Activated T-Cells, Cytoplasmic 2 (NFATC2) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Monkey Keratin, Type II Cytoskeletal 72 (KRT72) ELISA Kit
MBS9365239-01 48 Well

Monkey Keratin, Type II Cytoskeletal 72 (KRT72) ELISA Kit

Sign In for Pricing
View Details