Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf11 Rabbit Polyclonal Antibody (Biotin)

Klf11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tieg, Tieg2, Tieg3, Tieg2b, 9830142A17, D12Ertd427, D12Ertd427e

UniProt

Q8K1S5

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_848134

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr514 Protein Vector (Rat) (pPB-N-His)
PV290291 500 ng

Olr514 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CF150, ID (MB21D1, C6orf150, Protein MB21D1, Mab-21 domain-containing protein 1) (Biotin)
MBS6285317-01 0.2 mL

CF150, ID (MB21D1, C6orf150, Protein MB21D1, Mab-21 domain-containing protein 1) (Biotin)

Sign In for Pricing
View Details
CF150, ID (MB21D1, C6orf150, Protein MB21D1, Mab-21 domain-containing protein 1) (Biotin)
MBS6285317-02 5x 0.2 mL

CF150, ID (MB21D1, C6orf150, Protein MB21D1, Mab-21 domain-containing protein 1) (Biotin)

Sign In for Pricing
View Details
Strada 3'UTR Luciferase Stable Cell Line
TU221341 1.0 mL

Strada 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rat Naa16 Pre-designed siRNA Set A
SI208989A 1 Each

Rat Naa16 Pre-designed siRNA Set A

Sign In for Pricing
View Details
5,5'- (1,3-Propanediyl) bis[5H-dibenz[b, f]azepine]
437118-01 500 mg

5,5'- (1,3-Propanediyl) bis[5H-dibenz[b, f]azepine]

Sign In for Pricing
View Details