Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F7 Rabbit Polyclonal Antibody (FITC)

E2F7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

E2F-7, D10Ertd739, D10Ertd739e, A630014C11Rik

UniProt

Q6S7F2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2F7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LFRPIENKEDAFVNSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-SCNN1B (Ser633) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-5702R-PerCP-Cy5.5 100 µL

Phospho-SCNN1B (Ser633) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
CDC27 Rabbit Polyclonal Antibody
orb625649-01 50 µg

CDC27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC27 Rabbit Polyclonal Antibody
orb625649-02 100 µg

CDC27 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44V7, 8 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (Biotin) discontinued
C2398-96F 100 Tests

CD44V7, 8 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (Biotin) discontinued

Sign In for Pricing
View Details
Ephrin-B2 (F-2) Alexa Fluor® 647
sc-398735 AF647 200 µg/mL

Ephrin-B2 (F-2) Alexa Fluor® 647

Sign In for Pricing
View Details
Rabbit Monoclonal CD8 Antibody (C8/1779R) [Alexa Fluor 594]
NBP2-54595AF594 0.1 mL

Rabbit Monoclonal CD8 Antibody (C8/1779R) [Alexa Fluor 594]

Sign In for Pricing
View Details