Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F7 Rabbit Polyclonal Antibody (Biotin)

E2F7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

E2F-7, D10Ertd739, D10Ertd739e, A630014C11Rik

UniProt

Q6S7F2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse E2F7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFRPIENKEDAFVNSLQLDVAGDGAVDEYEKQRPSRKQKSLGLLCQKFLA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848724

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ttc19 shRNA (UAS) - Lentiviral mouse Ttc19 shRNA (UAS) (25)
GTR15253889 1 Vial

Lentiviral mouse Ttc19 shRNA (UAS) - Lentiviral mouse Ttc19 shRNA (UAS) (25)

Sign In for Pricing
View Details
FCGR1A (C) Antibody, Rabbit Polyclonal
orb67005 100 µL

FCGR1A (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Gem-Associated Protein 6 Human Recombinant
rAP-3918 1 Each

Gem-Associated Protein 6 Human Recombinant

Sign In for Pricing
View Details
Taar6 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3154403 1.0 µg DNA

Taar6 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Low Density Lipoprotein Receptor Related Protein 3 (LRP3)
SIPD169Hu01-01 10 µg

Recombinant Low Density Lipoprotein Receptor Related Protein 3 (LRP3)

Sign In for Pricing
View Details
Recombinant Low Density Lipoprotein Receptor Related Protein 3 (LRP3)
SIPD169Hu01-02 50 µg

Recombinant Low Density Lipoprotein Receptor Related Protein 3 (LRP3)

Sign In for Pricing
View Details