Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Slc2a12 Rabbit Polyclonal Antibody (HRP)

Slc2a12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Glut1, GLUT-1, Glut12, GLUT-12

UniProt

Q8BFW9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLFIPETKGCSLEQISVELAKANYVKNNICFMSHHQEELVPTQLQKRKPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_849265

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRAS Rabbit Polyclonal Antibody
orb1175464 100 µg

HRAS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Tyrosine-Protein Kinase Lyn (LYN) ELISA Kit
MBS9715428-01 48 Tests

Human Tyrosine-Protein Kinase Lyn (LYN) ELISA Kit

Sign In for Pricing
View Details
Human Tyrosine-Protein Kinase Lyn (LYN) ELISA Kit
MBS9715428-02 96 Tests

Human Tyrosine-Protein Kinase Lyn (LYN) ELISA Kit

Sign In for Pricing
View Details
Human Tyrosine-Protein Kinase Lyn (LYN) ELISA Kit
MBS9715428-03 5x 96 Tests

Human Tyrosine-Protein Kinase Lyn (LYN) ELISA Kit

Sign In for Pricing
View Details
2- (3,4-dimethoxyphenyl) -3- ((4-fluorophenyl) amino) inden-1-one
YQB87838 250 mg

2- (3,4-dimethoxyphenyl) -3- ((4-fluorophenyl) amino) inden-1-one

Sign In for Pricing
View Details
CD30-L (Q103) polyclonal antibody
orb643729-01 25 µL

CD30-L (Q103) polyclonal antibody

Sign In for Pricing
View Details