Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Txlng Rabbit Polyclonal Antibody (HRP)

Txlng Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Fi, Lrp, Fiat, 4932441K18Rik

UniProt

Q8BHN1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KADMVCNSQANDILQHQDPSCGGTTKKHSLEGDEGSDFITKNRNLVSSVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_849266

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OIP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H9]
TA810644BM 100 µL

OIP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H9]

Sign In for Pricing
View Details
Human Replication Initiator 1 (REPIN1) ELISA Kit
DLR-REPIN1-Hu-01 48 Tests

Human Replication Initiator 1 (REPIN1) ELISA Kit

Sign In for Pricing
View Details
Human Replication Initiator 1 (REPIN1) ELISA Kit
DLR-REPIN1-Hu-02 96 Tests

Human Replication Initiator 1 (REPIN1) ELISA Kit

Sign In for Pricing
View Details
Anti-Metalloproteinase inhibitor 1 TIMP1 Antibody Picoband®, Cy3 Conjugate
PA1385-Cy3 100 µg/Vial

Anti-Metalloproteinase inhibitor 1 TIMP1 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
TOMM22 3'UTR Lenti-reporter-Luc Vector
47285081 1.0 µg

TOMM22 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Elp2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3547304 1.0 µg DNA

Elp2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details