Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxn2 Rabbit Polyclonal Antibody (FITC)

Foxn2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HTL, HTLF, Fkh19, Foxn1, 3230402J05Rik, 6030465J18Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_851305

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bovine Tigger transposable element-derived protein 5 (TIGD5) , partial
MBS1144876 Inquire

Recombinant Bovine Tigger transposable element-derived protein 5 (TIGD5) , partial

Sign In for Pricing
View Details
TAF1D Protein Vector (Mouse) (pPM-C-His)
PV236141 500 ng

TAF1D Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Quickfit Joint Clip 2429 Green Conical Joint
QKC240 10 / PCK

Quickfit Joint Clip 2429 Green Conical Joint

Sign In for Pricing
View Details
ANO3 Protein Vector (Mouse) (pPM-C-His)
PV154777 500 ng

ANO3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Prion Protein (PRNP), BioAssayTM ELISA Kit (Human)
217887-01 48 Tests

Prion Protein (PRNP), BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Prion Protein (PRNP), BioAssayTM ELISA Kit (Human)
217887-02 96 Tests

Prion Protein (PRNP), BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details