Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxn2 Rabbit Polyclonal Antibody (HRP)

Foxn2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTL, HTLF, Fkh19, Foxn1, 3230402J05Rik, 6030465J18Rik

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_851305

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Insulin Like Protein 3 (INSL3) ELISA Kit
YLA1593MO-01 48 Tests

Mouse Insulin Like Protein 3 (INSL3) ELISA Kit

Sign In for Pricing
View Details
Mouse Insulin Like Protein 3 (INSL3) ELISA Kit
YLA1593MO-02 96 Tests

Mouse Insulin Like Protein 3 (INSL3) ELISA Kit

Sign In for Pricing
View Details
LMBRD1 Rabbit Polyclonal Antibody (BF488)
orb2481457 100 µL

LMBRD1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Rat Monoclonal LIX1 Antibody (RM0282-4F47) [Alexa Fluor 350]
NBP2-11779AF350 0.1 mL

Rat Monoclonal LIX1 Antibody (RM0282-4F47) [Alexa Fluor 350]

Sign In for Pricing
View Details
4- (2-fluorophenoxy) piperidine (HCl)
Fr212991-01 200 mg

4- (2-fluorophenoxy) piperidine (HCl)

Sign In for Pricing
View Details
4- (2-fluorophenoxy) piperidine (HCl)
Fr212991-02 5 mg

4- (2-fluorophenoxy) piperidine (HCl)

Sign In for Pricing
View Details