Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tppp Rabbit Polyclonal Antibody (FITC)

Tppp Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI849835, TPPP/p25, 2900041A09Rik

UniProt

Q7TQD2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQ

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_878259

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1077 Rat shRNA Lentiviral Particle (Locus ID 405280)
TL700342V 500 µL Each

Olr1077 Rat shRNA Lentiviral Particle (Locus ID 405280)

Sign In for Pricing
View Details
CCDC63 Recombinant Protein Antigen
NBP2-56562PEP 100 µL

CCDC63 Recombinant Protein Antigen

Sign In for Pricing
View Details
Gli3 ORF Vector (Rat) (pORF)
ORF067592 1.0 µg DNA

Gli3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Desulfovibrio desulfuricans Pantothenate synthetase (panC)
MBS1239064-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio desulfuricans Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Desulfovibrio desulfuricans Pantothenate synthetase (panC)
MBS1239064-02 0.02 mg (Yeast)

Recombinant Desulfovibrio desulfuricans Pantothenate synthetase (panC)

Sign In for Pricing
View Details
Recombinant Desulfovibrio desulfuricans Pantothenate synthetase (panC)
MBS1239064-03 0.1 mg (E-Coli)

Recombinant Desulfovibrio desulfuricans Pantothenate synthetase (panC)

Sign In for Pricing
View Details