Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOMEZ Rabbit Polyclonal Antibody (Biotin)

HOMEZ Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MKIAA1443

UniProt

Q80W88

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse HOMEZ

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSPLAPSEQPTHMKGLKVEPEEPSQVSQLPLNHQNAKEPLMMGSRTFSHQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_898997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNC (Tenascin C) ELISA Kit
E-EL-H6198-01 24 Tests

Human TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details
Human TNC (Tenascin C) ELISA Kit
E-EL-H6198-02 48 Tests

Human TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details
Human TNC (Tenascin C) ELISA Kit
E-EL-H6198-03 96 Tests

Human TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details
SuLT1A4 (NM_001017391) Human Recombinant Protein
TP304897M 100 µg

SuLT1A4 (NM_001017391) Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-IKB alpha (S32) Recombinant Rabbit Monoclonal Antibody [ST53-05]
ET1609-78 100 µL

Phospho-IKB alpha (S32) Recombinant Rabbit Monoclonal Antibody [ST53-05]

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB08F2-PAG 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details