Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Duxbl Rabbit Polyclonal Antibody (HRP)

Duxbl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dux, Duxb, Duxl, Duxbl, Duxbl2, Duxbl3, Gm10391, Gm10394, 1110051B16Rik

UniProt

Q7TNE6

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSQVVQQRSDDQNPNKGHLSPTTTPGEQGFHSQPPLQLLTQNRGHNPRES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_899245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS16 3'UTR Luciferase Stable Cell Line
TU019852 1.0 mL

RGS16 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Atp5j 3'UTR GFP Stable Cell Line
TU152331 1.0 mL

Atp5j 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)
MBS1348946-01 0.02 mg (E-Coli)

Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details
Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)
MBS1348946-02 0.1 mg (E-Coli)

Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details
Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)
MBS1348946-03 0.02 mg (Yeast)

Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details
Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)
MBS1348946-04 0.1 mg (Yeast)

Recombinant Bartonella henselae Integration host factor subunit alpha (ihfA)

Sign In for Pricing
View Details