Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRF3 Rabbit Polyclonal Antibody (Biotin)

TRF3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Trf, Trf3, Gm348

UniProt

Q6SJ95

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse TRF3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_951014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-human TNFRSF8 / CD30 (Brentuximab Biosimilar)
BIO0007SM-1mg 1 mg

Anti-human TNFRSF8 / CD30 (Brentuximab Biosimilar)

Sign In for Pricing
View Details
Bovine Fascin-2 (FSCN2) ELISA Kit
OM622339 96 Strip Well

Bovine Fascin-2 (FSCN2) ELISA Kit

Sign In for Pricing
View Details
Mouse Ifi214 qPCR Primer Pair
QM75510S 200 Tests

Mouse Ifi214 qPCR Primer Pair

Sign In for Pricing
View Details
Usp17lb (NM_201409) Mouse Tagged ORF Clone Lentiviral Particle
MR215468L3V 200 µL

Usp17lb (NM_201409) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Guinea pig Olfactory receptor 6M1 (OR6M1) ELISA Kit
MBS7231015-01 48 Well

Guinea pig Olfactory receptor 6M1 (OR6M1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Olfactory receptor 6M1 (OR6M1) ELISA Kit
MBS7231015-02 96 Well

Guinea pig Olfactory receptor 6M1 (OR6M1) ELISA Kit

Sign In for Pricing
View Details