Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRF3 Rabbit Polyclonal Antibody (Biotin)

TRF3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Trf, Trf3, Gm348

UniProt

Q6SJ95

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse TRF3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_951014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF3 (NM_001659) Human Recombinant Protein
TP306192 20 µg

ARF3 (NM_001659) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human CCL28 protein
MBS1561697-01 0.05 mg

Recombinant Human CCL28 protein

Sign In for Pricing
View Details
Recombinant Human CCL28 protein
MBS1561697-02 0.1 mg

Recombinant Human CCL28 protein

Sign In for Pricing
View Details
Recombinant Human CCL28 protein
MBS1561697-03 5x 0.1 mg

Recombinant Human CCL28 protein

Sign In for Pricing
View Details
ZNF79 antibody - N-terminal region (ARP35825_T100)
ARP35825_T100 100 µL

ZNF79 antibody - N-terminal region (ARP35825_T100)

Sign In for Pricing
View Details
PAFAH2 (NM_000437) Human Tagged Lenti ORF Clone
RC200355L3 10 µg

PAFAH2 (NM_000437) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details