Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXK1 Rabbit Polyclonal Antibody (FITC)

FOXK1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mn, Mnf, Gm10868, AI463295, A630048H08Rik

UniProt

P42128

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse FOXK1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_951031

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibrinopeptide B Rabbit Polyclonal Antibody (APC-Cy7)
orb2461403 100 µL

Fibrinopeptide B Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Anti-FHIT Antibody Picoband® (monoclonal, 26H7) (iFluor647 Conjugate)
M01200-iFluor647 100 µg

Anti-FHIT Antibody Picoband® (monoclonal, 26H7) (iFluor647 Conjugate)

Sign In for Pricing
View Details
Olfr550 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4199902 1.0 µg DNA

Olfr550 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal Maltose Binding Protein Antibody (R3.2) [Alexa Fluor 594]
NBP2-76652AF594 0.1 mL

Mouse Monoclonal Maltose Binding Protein Antibody (R3.2) [Alexa Fluor 594]

Sign In for Pricing
View Details
SULT1B1 shRNA (h) Lentiviral Particles
sc-89149-V 200 µL

SULT1B1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Nrp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
32179116 3x 1.0 µg

Nrp1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details