USP8, Human (sf9)
USP8 is a key hydrolase in cellular regulation and plays a crucial role in protein turnover by efficiently deubiquitinating proteins and preventing degradation. Its activity spans "Lys-48" and "Lys-63" linked ubiquitin chains, highlighting its versatility. USP8 Protein, Human (sf9) is the recombinant human-derived USP8 protein, expressed by Sf9 insect cells, with tag free.
Product Specifications
Product Name Alternative
USP8 Protein, Human (sf9), Human, Sf9 insect cells
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/usp8-protein-human-sf9.html
Purity
98.00
Smiles
PTVTPTVNRENKPTCYPKAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG
Molecular Formula
9101 (Gene_ID) P40818-1 (P734-G1110) (Accession)
Molecular Weight
43.5 KDa
Shipping Conditions
Dry ice.
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040204-100 1x 100 µL
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040460-100 1x 100 µL
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 