Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZHX2 Rabbit Polyclonal Antibody (HRP)

ZHX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

R, Af, Afr, Raf, Afr1, Afr-1, mKIAA0854

UniProt

Q8C0C0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse ZHX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGIVDFVEVTVGEEDAISEKWGSWSRRVAEGTVERADSDSDSTPAEAGQA

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_955520

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]
MBS2568421-01 50 Tests

PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]
MBS2568421-02 100 Tests

PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]
MBS2568421-03 2x 100 Tests

PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]
MBS2568421-04 10x 100 Tests

PE/Cyanine7 Anti-Rat CD45 Antibody [OX-1]

Sign In for Pricing
View Details
TM9SF3 Rabbit Polyclonal Antibody (PE)
orb2592877 100 µg

TM9SF3 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
AS160 Blocking Peptide
MBS8243430-01 1 mg

AS160 Blocking Peptide

Sign In for Pricing
View Details