Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sox10 Rabbit Polyclonal Antibody (FITC)

Sox10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Gt, Dom, Sox, Sox21

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human Sox10

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MLWESKGLHIQTSRTGSPFQGEEEPFMEPSAAAQSVSAVQPGCLVVRIQA

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

XP_128139

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMSAP3, NT (CAMSAP3, KIAA1543, Calmodulin-regulated spectrin-associated protein 3, Protein Nezha) (MaxLight 405) discontinued
033174-ML405 100 µL

CAMSAP3, NT (CAMSAP3, KIAA1543, Calmodulin-regulated spectrin-associated protein 3, Protein Nezha) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CD200 (OX2) (FITC) discontinued
C2548-96G-FITC 100 µL

CD200 (OX2) (FITC) discontinued

Sign In for Pricing
View Details
ZFP200 (ZNF200) Human Over-expression Lysate
orb1340230 100 µg

ZFP200 (ZNF200) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IgA (secretory) Mouse Monoclonal Antibody [Clone ID: SC-05]
SM3073P 100 µg

Human IgA (secretory) Mouse Monoclonal Antibody [Clone ID: SC-05]

Sign In for Pricing
View Details
SOX2-OT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV786265 1.0 µg DNA

SOX2-OT Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mmu-miR-452-3p agomir
HY-R03155A-01 5 nmol

Mmu-miR-452-3p agomir

Sign In for Pricing
View Details