Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOC100912020 Rabbit Polyclonal Antibody (FITC)

LOC100912020 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat LOC100912020

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TERQVKIWFQNRRMKWKKENNRDKFPASRPEAKDGDPKKEVSGLEEDGAE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

XP_003749540

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKAP6 ORF Vector (Human) (pORF)
11656011 1.0 µg DNA

AKAP6 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Glycerol, 85% (w/w)
40120569-1 500 mL

Glycerol, 85% (w/w)

Sign In for Pricing
View Details
SUMO4 Rabbit pAb (APR25123N)
APR25123N-01 50 µL

SUMO4 Rabbit pAb (APR25123N)

Sign In for Pricing
View Details
SUMO4 Rabbit pAb (APR25123N)
APR25123N-02 100 µL

SUMO4 Rabbit pAb (APR25123N)

Sign In for Pricing
View Details
SUMO4 Rabbit pAb (APR25123N)
APR25123N-03 200 µL

SUMO4 Rabbit pAb (APR25123N)

Sign In for Pricing
View Details
ALDH5A1 (Succinate-semialdehyde Dehydrogenase, Mitochondrial, Aldehyde Dehydrogenase Family 5 Member A1, NAD (+) -dependent Succinic Semialdehyde Dehydrogenase, SSADH)
A1334-36Q 100 µg

ALDH5A1 (Succinate-semialdehyde Dehydrogenase, Mitochondrial, Aldehyde Dehydrogenase Family 5 Member A1, NAD (+) -dependent Succinic Semialdehyde Dehydrogenase, SSADH)

Sign In for Pricing
View Details