Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3mbtl Rabbit Polyclonal Antibody (HRP)

L3mbtl Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

L3MBT, L3mbtl, mKIAA0681, C630004G01

UniProt

Q5DU20

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human L3mbtl

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKPMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQ

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

91kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

XP_900202

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-SLC25A48 Plasmid
PVT34537 2 µg

pCMV-SPORT6-SLC25A48 Plasmid

Sign In for Pricing
View Details
CDC37L1 Polyclonal Antibody
RD89641A-01 60 μL

CDC37L1 Polyclonal Antibody

Sign In for Pricing
View Details
CDC37L1 Polyclonal Antibody
RD89641A-02 120 μL

CDC37L1 Polyclonal Antibody

Sign In for Pricing
View Details
CDC37L1 Polyclonal Antibody
RD89641A-03 200 µL

CDC37L1 Polyclonal Antibody

Sign In for Pricing
View Details
GABARAPL1 (Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1, Early Estrogen-Regulated Protein, GABA (A) Receptor-Associated Protein-Like 1, Glandular Epithelial Cell Protein 1, GEC-1, GEC1)
406481-01 50 µL

GABARAPL1 (Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1, Early Estrogen-Regulated Protein, GABA (A) Receptor-Associated Protein-Like 1, Glandular Epithelial Cell Protein 1, GEC-1, GEC1)

Sign In for Pricing
View Details
GABARAPL1 (Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1, Early Estrogen-Regulated Protein, GABA (A) Receptor-Associated Protein-Like 1, Glandular Epithelial Cell Protein 1, GEC-1, GEC1)
406481-02 100 µL

GABARAPL1 (Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1, Early Estrogen-Regulated Protein, GABA (A) Receptor-Associated Protein-Like 1, Glandular Epithelial Cell Protein 1, GEC-1, GEC1)

Sign In for Pricing
View Details