Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gria1 Rabbit Polyclonal Antibody (HRP)

Gria1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Gl, HI, Glr, Glu, Glr1, Glur, Glr-1, GluA1, GluRA, Glur1, HIPA1, GluR-A, Glur-1, gluR-K1, 2900051M01Rik

UniProt

P23818

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106796

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGF Antibody
KC-12986-01 50 μL

PGF Antibody

Sign In for Pricing
View Details
PGF Antibody
KC-12986-02 100 µL

PGF Antibody

Sign In for Pricing
View Details
PGF Antibody
KC-12986-03 1 mL

PGF Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852J-01 20 Tests

PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852J-02 100 Tests

PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]
E-AB-F09852J-03 2x 100 Tests

PerCP/Cyanine5.5 Armenian Hamster IgG Isotype Control[PIP]

Sign In for Pricing
View Details