Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gria1 Rabbit Polyclonal Antibody (Biotin)

Gria1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gl, HI, Glr, Glu, Glr1, Glur, Glr-1, GluA1, GluRA, Glur1, HIPA1, GluR-A, Glur-1, gluR-K1, 2900051M01Rik

UniProt

P23818

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106796

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Nesprin-2
E15752h 96 Tests

ELISA Kit For Nesprin-2

Sign In for Pricing
View Details
Mouse mmu-miR-7659-3p miRNA Antagomir
abx889608-01 10 nmol

Mouse mmu-miR-7659-3p miRNA Antagomir

Sign In for Pricing
View Details
Mouse mmu-miR-7659-3p miRNA Antagomir
abx889608-02 20 nmol

Mouse mmu-miR-7659-3p miRNA Antagomir

Sign In for Pricing
View Details
Human Epigen (EPG) ELISA Kit
orb1666591-01 48 Tests

Human Epigen (EPG) ELISA Kit

Sign In for Pricing
View Details
Human Epigen (EPG) ELISA Kit
orb1666591-02 96 Tests

Human Epigen (EPG) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TMEFF1 Protein, His, E.coli-20ug
QP13762-20ug 20ug

Recombinant Human TMEFF1 Protein, His, E.coli-20ug

Sign In for Pricing
View Details