Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (Biotin)

KCNAB2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBP2 antibody
70R-33156 100 ug

FBP2 antibody

Sign In for Pricing
View Details
NARG1L AAV Vector (Human) (CMV)
31460101 1 µg

NARG1L AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1) (MaxLight 650)
MBS6352794-01 0.1 mL

SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1) (MaxLight 650)

Sign In for Pricing
View Details
SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1) (MaxLight 650)
MBS6352794-02 5x 0.1 mL

SYCE2, NT (SYCE2, CESC1, Synaptonemal complex central element protein 2, Central element synaptonemal complex protein 1) (MaxLight 650)

Sign In for Pricing
View Details
Mouse EGFR Protein, Fc Tag
E40MOP1010 20 µg

Mouse EGFR Protein, Fc Tag

Sign In for Pricing
View Details
PCK1 Antibody, HRP conjugated
CSB-PA017613LB01HU-01 50 µg

PCK1 Antibody, HRP conjugated

Sign In for Pricing
View Details