Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (FITC)

KCNAB2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Emamectin B1 Benzoate (Mixture of B1a and B1b)
TRC-E520503-2.5G 2.5 g

Emamectin B1 Benzoate (Mixture of B1a and B1b)

Sign In for Pricing
View Details
KAP1 (TRIM28) Mouse Monoclonal Antibody [Clone ID: OTI5E10]
CF813315 100 µg

KAP1 (TRIM28) Mouse Monoclonal Antibody [Clone ID: OTI5E10]

Sign In for Pricing
View Details
Dihydro Caffeic Acid 3-O-Sulfate Sodium Salt
TRC-D448710-25MG 25 mg

Dihydro Caffeic Acid 3-O-Sulfate Sodium Salt

Sign In for Pricing
View Details
Frozen Tissue Sections, Esophagus
CS501048 5x 5 µm

Frozen Tissue Sections, Esophagus

Sign In for Pricing
View Details
MGC13096 (PDCD2L) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
TA812472BM 100 µL

MGC13096 (PDCD2L) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details
Recombinant Mouse Decorin/DCN Protein (His Tag)
PKSM041003-01 10 µg

Recombinant Mouse Decorin/DCN Protein (His Tag)

Sign In for Pricing
View Details