Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (HRP)

KCNAB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ TMB Substrate Solution *Optimized for ELISA Assays with HRP Conjugates*
11012-AAT 100 mL

ReadiUse™ TMB Substrate Solution *Optimized for ELISA Assays with HRP Conjugates*

Sign In for Pricing
View Details
FibuLin 5 (FBLN5) (NM_006329) Human Over-expression Lysate
LY401904 100 µg

FibuLin 5 (FBLN5) (NM_006329) Human Over-expression Lysate

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF568 conjugate, 0.1mg/mL
BNC683605-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (rGFR/1667), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
smooth muscle Myosin heavy chain 11 Recombinant Rabbit Monoclonal Antibody [JA03-35]
ET1704-61 100 µL

smooth muscle Myosin heavy chain 11 Recombinant Rabbit Monoclonal Antibody [JA03-35]

Sign In for Pricing
View Details
Recombinant Human KIR2DL1/CD158a Protein (His Tag)
PDMH100354-01 20 µg

Recombinant Human KIR2DL1/CD158a Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human KIR2DL1/CD158a Protein (His Tag)
PDMH100354-02 100 µg

Recombinant Human KIR2DL1/CD158a Protein (His Tag)

Sign In for Pricing
View Details