Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB2 Rabbit Polyclonal Antibody (HRP)

KCNAB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AKR6A5, KCNA2B, HKvbeta2, KV-BETA-2, HKvbeta2.1, HKvbeta2.2

UniProt

Q13303

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNAB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003627

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Relatlimab Biosimilar - Research Grade
ICH5117-20mg 20 mg

Relatlimab Biosimilar - Research Grade

Sign In for Pricing
View Details
NFYC (NM_001142590) Human Over-expression Lysate
LY428193 100 µg

NFYC (NM_001142590) Human Over-expression Lysate

Sign In for Pricing
View Details
Colterol Hydrochloride
TRC-C215850-50MG 50 mg

Colterol Hydrochloride

Sign In for Pricing
View Details
CF®740 Goat Anti-Mouse IgG (H+L), 2 mg/mL
#20984-500uL 1x 500 µL

CF®740 Goat Anti-Mouse IgG (H+L), 2 mg/mL

Sign In for Pricing
View Details
HP1 gamma (CBX3) Mouse Monoclonal Antibody [Clone ID: 6F7-6A3-2B10]
TA383891 100 µL

HP1 gamma (CBX3) Mouse Monoclonal Antibody [Clone ID: 6F7-6A3-2B10]

Sign In for Pricing
View Details
KLF2 Mouse Monoclonal Antibody [Clone ID: OTI3D10]
CF806989 100 µg

KLF2 Mouse Monoclonal Antibody [Clone ID: OTI3D10]

Sign In for Pricing
View Details