Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNG4 Rabbit Polyclonal Antibody (HRP)

CACNG4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9UBN1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ACE Antibody Pair Set
E-KAB-0721 50 µL & 100 µg

Rat ACE Antibody Pair Set

Sign In for Pricing
View Details
UACA / Nucling (UACA/1222), CF640R conjugate, 0.1mg/mL
BNC401222-100 1x 100 µL

UACA / Nucling (UACA/1222), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF640R conjugate, 0.1mg/mL
BNC403439-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (TYR/2024R), CF488A conjugate, 0.1mg/mL
BNC882024-500 1x 500 µL

Tyrosinase (Melanoma Marker) (TYR/2024R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFluor® 710 Anti-human CD3 Antibody *SK7*
100330K0-AAT 100 Tests

IFluor® 710 Anti-human CD3 Antibody *SK7*

Sign In for Pricing
View Details
RAC2 Polyclonal Antibody
E-AB-40245-01 25 µL

RAC2 Polyclonal Antibody

Sign In for Pricing
View Details