Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN3B Rabbit Polyclonal Antibody (HRP)

SCN3B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCNB3, ATFB16, BRGDA7, HSA243396

UniProt

Q9NY72

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SCN3B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060870

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human BIRC6 sgRNA gene knockout kit - Lentiviral human BIRC6 sgRNA gene knockout kit (plasmid)
GTR15386198 1 Vial

Lentiviral human BIRC6 sgRNA gene knockout kit - Lentiviral human BIRC6 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit
orb1654705-01 48 Tests

Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit

Sign In for Pricing
View Details
Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit
orb1654705-02 96 Tests

Rat Neural cell adhesion molecule 1 (NCAM1) ELISA Kit

Sign In for Pricing
View Details
SPN/CD43, NT (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD43) (MaxLight 750)
MBS6350671-01 0.1 mL

SPN/CD43, NT (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD43) (MaxLight 750)

Sign In for Pricing
View Details
SPN/CD43, NT (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD43) (MaxLight 750)
MBS6350671-02 5x 0.1 mL

SPN/CD43, NT (SPN, CD43, Leukosialin, Galactoglycoprotein, Leukocyte sialoglycoprotein, Sialophorin, CD43) (MaxLight 750)

Sign In for Pricing
View Details
Bovine Thyroglobulin (TG) ELISA Kit
AE17157BO-01 48 Tests

Bovine Thyroglobulin (TG) ELISA Kit

Sign In for Pricing
View Details