Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCTD6 Rabbit Polyclonal Antibody (HRP)

KCTD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KCASH3

UniProt

Q8TCA6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KCTD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVV

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_699162

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Jun (phospho-S63) polyclonal antibody
BS4045-01 50 µL

C-Jun (phospho-S63) polyclonal antibody

Sign In for Pricing
View Details
C-Jun (phospho-S63) polyclonal antibody
BS4045-02 100 µL

C-Jun (phospho-S63) polyclonal antibody

Sign In for Pricing
View Details
Mouse Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) ELISA Development Kit
abx378621-01 5x 96 Tests

Mouse Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) ELISA Development Kit

Sign In for Pricing
View Details
Mouse Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) ELISA Development Kit
abx378621-02 15x 96 Tests

Mouse Low Affinity Immunoglobulin Epsilon Fc Receptor (FCER2) ELISA Development Kit

Sign In for Pricing
View Details
Recombinant KMT1B Antibody
RC-15878-01 50 μL

Recombinant KMT1B Antibody

Sign In for Pricing
View Details
Recombinant KMT1B Antibody
RC-15878-02 100 µL

Recombinant KMT1B Antibody

Sign In for Pricing
View Details