Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX46 Rabbit Polyclonal Antibody (Biotin)

DDX46 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Prp5, PRPF5

UniProt

Q7L014

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX46

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ARID1A shRNA (UAS) - Lentiviral human ARID1A shRNA (UAS) (25)
GTR15094217 1 Vial

Lentiviral human ARID1A shRNA (UAS) - Lentiviral human ARID1A shRNA (UAS) (25)

Sign In for Pricing
View Details
Cleaved-Cathepsin D LC (G65) Polyclonal Antibody
orb1416142 100 µL

Cleaved-Cathepsin D LC (G65) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit 53BP1 Antibody Pack
NB100-926-1Pack 1 Pack

Rabbit 53BP1 Antibody Pack

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF835 Antibody
NBP1-80200 100 µL

Rabbit Polyclonal ZNF835 Antibody

Sign In for Pricing
View Details
Thymosin beta 4 Rabbit Polyclonal Antibody (BF680)
orb2372354 100 µL

Thymosin beta 4 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Camkv 3'UTR Luciferase Stable Cell Line
TU103081 1.0 mL

Camkv 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details