Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX46 Rabbit Polyclonal Antibody (FITC)

DDX46 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Prp5, PRPF5

UniProt

Q7L014

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX46

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP8B4 Human Gene Knockout Kit (CRISPR)
KN416096 1 Kit

ATP8B4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
iFluor™ 488 Conjugated pan Cytokeratin Recombinant Mouse Monoclonal Antibody [PDH0-10]
HA600111F 100 µL

iFluor™ 488 Conjugated pan Cytokeratin Recombinant Mouse Monoclonal Antibody [PDH0-10]

Sign In for Pricing
View Details
Mouse Etv4 activation kit by CRISPRa
GA203169 1 Kit

Mouse Etv4 activation kit by CRISPRa

Sign In for Pricing
View Details
EnzyFluo™ Human/Mouse LKB1 (S431) Phosphorylation ELISA Kit
ELKB1-100 100 Tests

EnzyFluo™ Human/Mouse LKB1 (S431) Phosphorylation ELISA Kit

Sign In for Pricing
View Details
Natural Convection Incubator BINC-7802
BINC-7802 1 Unit

Natural Convection Incubator BINC-7802

Sign In for Pricing
View Details
4-Pyridinecarboxylic Acid Ethyl Ester
TRC-P991795-10G 10 g

4-Pyridinecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details