Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX46 Rabbit Polyclonal Antibody (FITC)

DDX46 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Prp5, PRPF5

UniProt

Q7L014

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX46

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS700164 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
C12orf60 (NM_175874) Human Recombinant Protein
TP307948M 100 µg

C12orf60 (NM_175874) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Phospho-Girdin (Tyr1765) Monoclonal Antibody
AN302074L-01 50 µL

Recombinant Phospho-Girdin (Tyr1765) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-Girdin (Tyr1765) Monoclonal Antibody
AN302074L-02 100 µL

Recombinant Phospho-Girdin (Tyr1765) Monoclonal Antibody

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL
BNC041587-500 1x 500 µL

CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GIRK2 (KCNJ6) activation kit by CRISPRa
GA102539 1 Kit

Human GIRK2 (KCNJ6) activation kit by CRISPRa

Sign In for Pricing
View Details