Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX46 Rabbit Polyclonal Antibody (HRP)

DDX46 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Prp5, PRPF5

UniProt

Q7L014

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX46

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA3 (TAAR9) (NM_175057) Human Tagged Lenti ORF Clone
RC223711L1 10 µg

TA3 (TAAR9) (NM_175057) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRAF2 (G-3) : m-IgG Fc BP-HRP Bundle
sc-537385 1 Kit

TRAF2 (G-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Human Thioredoxin Reductase ELISA Kit
MBS3802924-01 48 Well

Human Thioredoxin Reductase ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin Reductase ELISA Kit
MBS3802924-02 96 Well

Human Thioredoxin Reductase ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin Reductase ELISA Kit
MBS3802924-03 5x 96 Well

Human Thioredoxin Reductase ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin Reductase ELISA Kit
MBS3802924-04 10x 96 Well

Human Thioredoxin Reductase ELISA Kit

Sign In for Pricing
View Details