Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF35 Rabbit Polyclonal Antibody (HRP)

ZNF35 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HF10, HF.10, Zfp105

UniProt

P13682

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF35

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASSQQVHSENIKVWAPVQGLQTGLDGSEEEEKGQNISWDMAVVLKATQEA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_003411

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrp1 Mouse siRNA Oligo Duplex (Locus ID 22178)
SR416956 1 Kit

Tyrp1 Mouse siRNA Oligo Duplex (Locus ID 22178)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492)
MBS7038764-01 0.02 mg

Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492)
MBS7038764-02 0.1 mg

Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492)

Sign In for Pricing
View Details
Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492)
MBS7038764-03 5x 0.1 mg

Recombinant Mycobacterium sp. UPF0353 protein Mjls_2492 (Mjls_2492)

Sign In for Pricing
View Details
Acot2 Rat shRNA Plasmid (Locus ID 192272)
TL712962 1 Kit

Acot2 Rat shRNA Plasmid (Locus ID 192272)

Sign In for Pricing
View Details
Rabbit Monoclonal 53BP1 Antibody (1285A)
MAB18771 100 µg

Rabbit Monoclonal 53BP1 Antibody (1285A)

Sign In for Pricing
View Details