Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDF1 Rabbit Polyclonal Antibody (FITC)

EDF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MBF1, EDF-1, CFAP280

UniProt

O60869

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EDF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RBFOX3/NeuN Antibody (PD01-45)
NBP3-32644 100 µL

Mouse Monoclonal RBFOX3/NeuN Antibody (PD01-45)

Sign In for Pricing
View Details
S100A6 Antibody
A46126-100UL 100 µL

S100A6 Antibody

Sign In for Pricing
View Details
MVK (Mevalonate Kinase, MK, MVLK, FLJ96772, LRBP) (HRP)
MBS6386197-01 0.1 mL

MVK (Mevalonate Kinase, MK, MVLK, FLJ96772, LRBP) (HRP)

Sign In for Pricing
View Details
MVK (Mevalonate Kinase, MK, MVLK, FLJ96772, LRBP) (HRP)
MBS6386197-02 5x 0.1 mL

MVK (Mevalonate Kinase, MK, MVLK, FLJ96772, LRBP) (HRP)

Sign In for Pricing
View Details
CD31/PECAM1 Rabbit Polyclonal Antibody (Fluoro488)
orb3081144 100 µg

CD31/PECAM1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
LAMTOR3 siRNA (Human)
MBS8228224-01 15 nmol

LAMTOR3 siRNA (Human)

Sign In for Pricing
View Details