Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDF1 Rabbit Polyclonal Antibody (HRP)

EDF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MBF1, EDF-1, CFAP280

UniProt

O60869

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human EDF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL48 Antibody (FITC)
orb355685-01 50 µg

MRPL48 Antibody (FITC)

Sign In for Pricing
View Details
MRPL48 Antibody (FITC)
orb355685-02 100 µg

MRPL48 Antibody (FITC)

Sign In for Pricing
View Details
ZNF512 Human Over-expression Lysate
orb1351627 100 µg

ZNF512 Human Over-expression Lysate

Sign In for Pricing
View Details
Centrin-1+Centrin-2 Rabbit Polyclonal Antibody (BF405)
orb2520718 100 µL

Centrin-1+Centrin-2 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
CD45 Mouse Monoclonal Antibody (BF680)
orb1605292 100 µL

CD45 Mouse Monoclonal Antibody (BF680)

Sign In for Pricing
View Details
Γ- (6-Aminohexyl) -GTP-6-FAM
NU-834-6FM 160 μL

Γ- (6-Aminohexyl) -GTP-6-FAM

Sign In for Pricing
View Details