Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED21 Rabbit Polyclonal Antibody (Biotin)

MED21 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SRB7, SURB7, hSrb7

UniProt

Q13503

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MED21

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Zinc finger CCHC domain containing protein 8 (ZCCHC8) ELISA Kit
GTR10361717 96 Well

Canine Zinc finger CCHC domain containing protein 8 (ZCCHC8) ELISA Kit

Sign In for Pricing
View Details
Human Advanced Oxidation Protein Products (AOPP) ELISA Kit
MBS3801391-01 48 Well

Human Advanced Oxidation Protein Products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Human Advanced Oxidation Protein Products (AOPP) ELISA Kit
MBS3801391-02 96 Well

Human Advanced Oxidation Protein Products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Human Advanced Oxidation Protein Products (AOPP) ELISA Kit
MBS3801391-03 5x 96 Well

Human Advanced Oxidation Protein Products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Human Advanced Oxidation Protein Products (AOPP) ELISA Kit
MBS3801391-04 10x 96 Well

Human Advanced Oxidation Protein Products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Vascular Endothelial Growth Factor C (VEGFC) Antibody Pair
abx370292-01 5x 96 Tests

Vascular Endothelial Growth Factor C (VEGFC) Antibody Pair

Sign In for Pricing
View Details