Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED21 Rabbit Polyclonal Antibody (FITC)

MED21 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SRB7, SURB7, hSrb7

UniProt

Q13503

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MED21

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DSLPSEESTAALQAASLYKLEEENHEAATCLEDVVYRGDMLLEKIQSALA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004255

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Ameloblastin
E14174p 96 Tests

ELISA Kit For Ameloblastin

Sign In for Pricing
View Details
Mouse Monoclonal HSP60 Antibody (HSPD1/875) [HRP]
NBP2-47844H 0.1 mL

Mouse Monoclonal HSP60 Antibody (HSPD1/875) [HRP]

Sign In for Pricing
View Details
CD40 (Tumor Necrosis Factor Receptor Superfamily Member 5, B Cell Surface Antigen CD40, Bp50, CD40L Receptor, CDw40, TNFRSF5) (MaxLight 650)
MBS6221345-01 0.1 mL

CD40 (Tumor Necrosis Factor Receptor Superfamily Member 5, B Cell Surface Antigen CD40, Bp50, CD40L Receptor, CDw40, TNFRSF5) (MaxLight 650)

Sign In for Pricing
View Details
CD40 (Tumor Necrosis Factor Receptor Superfamily Member 5, B Cell Surface Antigen CD40, Bp50, CD40L Receptor, CDw40, TNFRSF5) (MaxLight 650)
MBS6221345-02 5x 0.1 mL

CD40 (Tumor Necrosis Factor Receptor Superfamily Member 5, B Cell Surface Antigen CD40, Bp50, CD40L Receptor, CDw40, TNFRSF5) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae rplY Protein (aa 1-190) (strain ATCC 700825 / FA 1090)
VAng-Wyb2787-200gEcoli 200 µg (E. coli)

Recombinant Neisseria Gonorrhoeae rplY Protein (aa 1-190) (strain ATCC 700825 / FA 1090)

Sign In for Pricing
View Details
AdmiRa-rno-miR-873-5p Virus
mr0952 250 µL

AdmiRa-rno-miR-873-5p Virus

Sign In for Pricing
View Details