Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA1 Rabbit Polyclonal Antibody (FITC)

MTA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q13330

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MTA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNW

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAN01613

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human APBB1 qPCR Primer Pair
QH10381S 200 Tests

Human APBB1 qPCR Primer Pair

Sign In for Pricing
View Details
1,4-Dihydro-2- (methylthio) -4-oxo-5-pyrimidine-carboxylate acid ethyl ester
411321-01 100 mg

1,4-Dihydro-2- (methylthio) -4-oxo-5-pyrimidine-carboxylate acid ethyl ester

Sign In for Pricing
View Details
1,4-Dihydro-2- (methylthio) -4-oxo-5-pyrimidine-carboxylate acid ethyl ester
411321-02 250 mg

1,4-Dihydro-2- (methylthio) -4-oxo-5-pyrimidine-carboxylate acid ethyl ester

Sign In for Pricing
View Details
Sheep vitamin D (VD) ELISA Kit
YP-W74906-01 48 Tests

Sheep vitamin D (VD) ELISA Kit

Sign In for Pricing
View Details
Sheep vitamin D (VD) ELISA Kit
YP-W74906-02 96 Tests

Sheep vitamin D (VD) ELISA Kit

Sign In for Pricing
View Details
Transglutaminase, ID (T428) (Protein-glutamine gamma-glutamyltransferase 2, Tissue Transglutaminase, Transglutaminase C, TGase C, TGC, TG(C), Transglutaminase-2, TGase-2, Transglutaminase H, TGase-H, TGM2)
MBS624420-01 0.2 mL

Transglutaminase, ID (T428) (Protein-glutamine gamma-glutamyltransferase 2, Tissue Transglutaminase, Transglutaminase C, TGase C, TGC, TG(C), Transglutaminase-2, TGase-2, Transglutaminase H, TGase-H, TGM2)

Sign In for Pricing
View Details