Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA1 Rabbit Polyclonal Antibody (HRP)

MTA1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q13330

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MTA1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MPSRGLANHGQARHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNW

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAN01613

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUF 5834 discontinued. See 453955
255711-01 10 mg

LUF 5834 discontinued. See 453955

Sign In for Pricing
View Details
LUF 5834 discontinued. See 453955
255711-02 50 mg

LUF 5834 discontinued. See 453955

Sign In for Pricing
View Details
Feline Leukemia Virus, gp70 (FeLV) (MaxLight 650)
137950-ML650 100 µL

Feline Leukemia Virus, gp70 (FeLV) (MaxLight 650)

Sign In for Pricing
View Details
GWB-BFAB40-100UG - Anti- ASK1 (Ab-83) Antibody
GWB-BFAB40-100UG 100 µg

GWB-BFAB40-100UG - Anti- ASK1 (Ab-83) Antibody

Sign In for Pricing
View Details
Vmn1r181 Recombinant Protein (Mouse)
RP184055 100 µg

Vmn1r181 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit Polyclonal IFITM1 Antibody [Alexa Fluor 488]
NBP1-77171AF488 0.1 mL

Rabbit Polyclonal IFITM1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details