Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ncoa4 Rabbit Polyclonal Antibody (Biotin)

Ncoa4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Rfg, ARA70

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001029160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human AGBL3 shRNA (UAS) - Lentiviral human AGBL3 shRNA (UAS, iRFP) (100)
GTR15340314 1 Vial

Lentiviral human AGBL3 shRNA (UAS) - Lentiviral human AGBL3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Kctd19 3'UTR Luciferase Stable Cell Line
TU206637 1.0 mL

Kctd19 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Zebrafish TLR9 Protein, N-His
orb2961806-01 50 µg

Recombinant Zebrafish TLR9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Zebrafish TLR9 Protein, N-His
orb2961806-02 100 µg

Recombinant Zebrafish TLR9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Zebrafish TLR9 Protein, N-His
orb2961806-03 1 mg

Recombinant Zebrafish TLR9 Protein, N-His

Sign In for Pricing
View Details
MAGI3 Protein Vector (Human) (pPB-N-His)
PV054942 500 ng

MAGI3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details