Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ncoa4 Rabbit Polyclonal Antibody (FITC)

Ncoa4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Rfg, ARA70

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CLIHQLEYTQNKDLANQVSVCLERLGSLALKPEDSTVLLFEADTSALRQT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001029160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C13orf27 siRNA Oligos set (Human)
13799171 3x 5 nmol

C13orf27 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Imidazole Buffer 0.5M, pH 7.0
NBB-2114-01 100 mL

Imidazole Buffer 0.5M, pH 7.0

Sign In for Pricing
View Details
Imidazole Buffer 0.5M, pH 7.0
NBB-2114-02 250 mL

Imidazole Buffer 0.5M, pH 7.0

Sign In for Pricing
View Details
AKT1 (RAC-alpha Serine/Threonine-protein Kinase, RAC-PK-alpha, Protein Kinase B, PKB, Proto-oncogene c-Akt, PKB, RAC) (MaxLight 490)
123180-ML490 100 µL

AKT1 (RAC-alpha Serine/Threonine-protein Kinase, RAC-PK-alpha, Protein Kinase B, PKB, Proto-oncogene c-Akt, PKB, RAC) (MaxLight 490)

Sign In for Pricing
View Details
Helicobacter pylori (MaxLight 490) discontinued
H1840-15G-ML490 100 µL

Helicobacter pylori (MaxLight 490) discontinued

Sign In for Pricing
View Details
BMP3 (Bone Morphogenetic Protein 3, BMP3A, BMP-3A, Osteogenic)
362297 200 µL

BMP3 (Bone Morphogenetic Protein 3, BMP3A, BMP-3A, Osteogenic)

Sign In for Pricing
View Details