Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF192 Rabbit Polyclonal Antibody (HRP)

ZNF192 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LD5-1, ZNF192, ZSCAN40

UniProt

Q15776

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF192

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_006289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), 1mg/mL
BNUM2095-50 1x 50 µL

HSV1 (Herpes Simplex Virus Type I) (HSVI/2095), 1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL
BNC741205-500 1x 500 µL

Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GLT1D1 activation kit by CRISPRa
GA115496 1 Kit

Human GLT1D1 activation kit by CRISPRa

Sign In for Pricing
View Details
p21 Antibody (phospho-T57)
F48425-0.08ML 0.08 mL

p21 Antibody (phospho-T57)

Sign In for Pricing
View Details
Aldoa Mouse Gene Knockout Kit (CRISPR)
KN501129 1 Kit

Aldoa Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
myosin heavy chain 3 (MYH3) (NM_002470) Human Recombinant Protein
TP318098L 1 mg

myosin heavy chain 3 (MYH3) (NM_002470) Human Recombinant Protein

Sign In for Pricing
View Details