Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBF2 Rabbit Polyclonal Antibody (FITC)

EBF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

COE2, OE-3, EBF-2, O/E-3

UniProt

B7Z934

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EBF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DIAEALYSVPRNPSQLPALSSSPAHSGMMGINSYGSQLGVSISESTQGNN

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT17 Antibody - C-terminal region : HRP (ARP48510_P050-HRP)
ARP48510_P050-HRP 100 µL

NUDT17 Antibody - C-terminal region : HRP (ARP48510_P050-HRP)

Sign In for Pricing
View Details
Myadm (NM_001093764) Mouse Tagged ORF Clone
MR218080 10 µg

Myadm (NM_001093764) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-WDR92 Rabbit pAb
GB112689 100 μL

Anti-WDR92 Rabbit pAb

Sign In for Pricing
View Details
REV1 shRNA Plasmid (h)
sc-38232-SH 20 µg

REV1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 20 (TAS2R20)
orb2906739-01 20 µg

Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 20 (TAS2R20)

Sign In for Pricing
View Details
Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 20 (TAS2R20)
orb2906739-02 100 µg

Recombinant Gorilla gorilla gorilla Taste receptor type 2 member 20 (TAS2R20)

Sign In for Pricing
View Details