Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHOXF2 Rabbit Polyclonal Antibody (FITC)

RHOXF2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

THG1, CT107, PEPP2, PEPP-2

UniProt

Q9BQY4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RHOXF2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

IHC, WB

NCBI Accession Number

NP_115887

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamine PRPP amidotransferase Rabbit Polyclonal Antibody (PerCP)
orb2401265 100 µL

Glutamine PRPP amidotransferase Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
ANP32E Protein Vector (Mouse) (pPB-C-His)
PV154818 500 ng

ANP32E Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Ptk2, ID (Ptk2, Fadk, Fak, Fak1, Kiaa4203, Focal adhesion kinase 1, Focal adhesion kinase-related nonkinase, Protein-tyrosine kinase 2, p125FAK, pp125FAK) (MaxLight 750) discontinued
040636-ML750 100 µL

Ptk2, ID (Ptk2, Fadk, Fak, Fak1, Kiaa4203, Focal adhesion kinase 1, Focal adhesion kinase-related nonkinase, Protein-tyrosine kinase 2, p125FAK, pp125FAK) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SCF non-lytic Recombinant Protein
90-540 50 µg

SCF non-lytic Recombinant Protein

Sign In for Pricing
View Details
Lentiviral human GLG1 shRNA (UAS) - Lentiviral human GLG1 shRNA (UAS, RFP) (25)
GTR15138695 1 Vial

Lentiviral human GLG1 shRNA (UAS) - Lentiviral human GLG1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
BTNL8, ID (BTNL8, Butyrophilin-like protein 8) (MaxLight 405) discontinued
032625-ML405 100 µL

BTNL8, ID (BTNL8, Butyrophilin-like protein 8) (MaxLight 405) discontinued

Sign In for Pricing
View Details