Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLI4 Rabbit Polyclonal Antibody (HRP)

GLI4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKR4, ZNF928

UniProt

P10075

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GLI4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_612474

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slfn2 shRNA Plasmid (m)
sc-40925-SH 20 µg

Slfn2 shRNA Plasmid (m)

Sign In for Pricing
View Details
MouseExoPure™ 0.4 micron Immunobeads (Overall Exosome Isolation, mouse cell media, 20 reactions)
M1036-20 5 Reactions

MouseExoPure™ 0.4 micron Immunobeads (Overall Exosome Isolation, mouse cell media, 20 reactions)

Sign In for Pricing
View Details
INTERFERON GAMMA Monoclonal Antibody (Capture)
orb26592 1 mg

INTERFERON GAMMA Monoclonal Antibody (Capture)

Sign In for Pricing
View Details
PKAα cat (H-8)
sc-515039 200 µg/mL

PKAα cat (H-8)

Sign In for Pricing
View Details
MAP Kinase Interacting Serine/threonine Kinase 2, CT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (AP)
MBS6486627-01 0.2 mL

MAP Kinase Interacting Serine/threonine Kinase 2, CT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (AP)

Sign In for Pricing
View Details
MAP Kinase Interacting Serine/threonine Kinase 2, CT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (AP)
MBS6486627-02 5x 0.2 mL

MAP Kinase Interacting Serine/threonine Kinase 2, CT (MAP Kinase Signal-integrating Kinase 2, MAPK Signal-integrating Kinase 2, MKNK2, MNK2, GPRK7) (AP)

Sign In for Pricing
View Details