Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LASS5 Rabbit Polyclonal Antibody (Biotin)

LASS5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Trh4, LASS5

UniProt

Q8N5B7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LASS5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CALCIGIEDSGPYQAQPNAILEKVFISITKYPDKKRLEGLSKQLDWNVRK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_671723

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Telomerase protein component 1 (TEP1) Human ELISA Kit
H5032 96 Tests

Telomerase protein component 1 (TEP1) Human ELISA Kit

Sign In for Pricing
View Details
Chicken Retinol Binding Protein 1, RBP1 ELISA KIT
E0323Ch-01 48 Well

Chicken Retinol Binding Protein 1, RBP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Retinol Binding Protein 1, RBP1 ELISA KIT
E0323Ch-02 96 Well

Chicken Retinol Binding Protein 1, RBP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Retinol Binding Protein 1, RBP1 ELISA KIT
E0323Ch-03 5x 96 Tests

Chicken Retinol Binding Protein 1, RBP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Retinol Binding Protein 1, RBP1 ELISA KIT
E0323Ch-04 10x 96 Tests

Chicken Retinol Binding Protein 1, RBP1 ELISA KIT

Sign In for Pricing
View Details
Anti-CD20/MS4A1 (DXLr120) Biosimilar (Monoclonal, IgG)
A135826 100 µL

Anti-CD20/MS4A1 (DXLr120) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details