Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP62 Rabbit Polyclonal Antibody (Biotin)

ZFP62 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZET, ZNF755

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFP62

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HKRIHTGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFIT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_936733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SORT1 Protein, N-GST
YHJ44201 100 μg

Recombinant Human SORT1 Protein, N-GST

Sign In for Pricing
View Details
Synapsin III (SYN3) (NM_003490) Human Recombinant Protein
PH34934M5 20 µg

Synapsin III (SYN3) (NM_003490) Human Recombinant Protein

Sign In for Pricing
View Details
AIF Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-0037R-BF680-TR 20 µL

AIF Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit BPI Fold-Containing Family B Member 1 (BPIFB1) ELISA Kit
MBS9932678 Inquire

Rabbit BPI Fold-Containing Family B Member 1 (BPIFB1) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Integrin alpha 4/CD49d Antibody (9F10) [mFluor Violet 610 SE]
NBP1-43398MFV610 0.1 mL

Mouse Monoclonal Integrin alpha 4/CD49d Antibody (9F10) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Phospho-CDK1 (Tyr15) Rabbit Polyclonal Antibody
AF5761 50 µL

Phospho-CDK1 (Tyr15) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details