Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP62 Rabbit Polyclonal Antibody (HRP)

ZFP62 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZET, ZNF755

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZFP62

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HKRIHTGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFIT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_936733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin beta C chain (INHBC) (NM_005538) Human Over-expression Lysate
LY401700 100 µg

Inhibin beta C chain (INHBC) (NM_005538) Human Over-expression Lysate

Sign In for Pricing
View Details
SHP1 (PTPN6) (NM_002831) Human Over-expression Lysate
LC401007 20 µg

SHP1 (PTPN6) (NM_002831) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Peripheral nerve
CS800085 5x 5 µm

Tissue FFPE Sections, Peripheral nerve

Sign In for Pricing
View Details
PITPNB Mouse Monoclonal Antibody [Clone ID: OTI4A7]
CF809353 100 µg

PITPNB Mouse Monoclonal Antibody [Clone ID: OTI4A7]

Sign In for Pricing
View Details
Cathepsin H (CTSH) Human Gene Knockout Kit (CRISPR)
KN400373 1 Kit

Cathepsin H (CTSH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZFAND5 (NM_001102420) Human Over-expression Lysate
LC420147 20 µg

ZFAND5 (NM_001102420) Human Over-expression Lysate

Sign In for Pricing
View Details