Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp872 Rabbit Polyclonal Antibody (Biotin)

Zfp872 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

9530015I07Rik

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CHSEHTQWESHGFRGKLYQCKDCGKAFSFQSSFRIHERTHTGEKPYMCKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATAD2A (Transcriptional Repressor p66-alpha, Hp66alpha, GATA Zinc Finger Domain-containing Protein 2A, FLJ20085, FLJ21017) (MaxLight 550)
127188-ML550 100 µL

GATAD2A (Transcriptional Repressor p66-alpha, Hp66alpha, GATA Zinc Finger Domain-containing Protein 2A, FLJ20085, FLJ21017) (MaxLight 550)

Sign In for Pricing
View Details
EPHB1 Antibody
orb195188-01 50 μL

EPHB1 Antibody

Sign In for Pricing
View Details
EPHB1 Antibody
orb195188-02 100 µL

EPHB1 Antibody

Sign In for Pricing
View Details
ROC1/RBX1 Rabbit Polyclonal Antibody (Fluoro488)
orb3075699 100 µg

ROC1/RBX1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Water Bath BBWA-302
BBWA-302 1 Unit

Water Bath BBWA-302

Sign In for Pricing
View Details
BID Knockout HGC-27 Polyclonal Cells
ARG29723 1 Million

BID Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details