Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp872 Rabbit Polyclonal Antibody (FITC)

Zfp872 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

9530015I07Rik

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CHSEHTQWESHGFRGKLYQCKDCGKAFSFQSSFRIHERTHTGEKPYMCKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001028985

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPT / TAU pSer262 Rabbit Polyclonal Antibody
AP01705PU-N 100 µg

MAPT / TAU pSer262 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SensiStain™ Anti-IDH1 R132H Antibody
HY000270 0.1 mL

SensiStain™ Anti-IDH1 R132H Antibody

Sign In for Pricing
View Details
Spryd4 Mouse Gene Knockout Kit (CRISPR)
KN516673 1 Kit

Spryd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100A1 (Melanoma Marker) (S100A1/1942), CF488A conjugate, 0.1mg/mL
BNC881942-500 1x 500 µL

S100A1 (Melanoma Marker) (S100A1/1942), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Double Beam UV Visible Spectrophotometer BSDBU-302
BSDBU-302 Each

Double Beam UV Visible Spectrophotometer BSDBU-302

Sign In for Pricing
View Details
U1A (SNRPA) Human Gene Knockout Kit (CRISPR)
KN401818 1 Kit

U1A (SNRPA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details